PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015876904.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 743aa    MW: 83759.3 Da    PI: 5.7633
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015876904.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS393.62.2e-1203697401374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lL+ cA+av+++dl+ a+++L+++++++sp+gd mqR+a+yf+ +L+ar+a+s++++ k+l +++ts    ++ l+a++lf  ++P+ k+s+
  XP_015876904.1 369 LRTLLTLCAQAVAADDLRTANEFLKQIRQHSSPTGDGMQRIAHYFADGLEARIAGSGTQIHKTLITWPTS---AADILKAYHLFLAACPFKKLSN 460
                     5789*****************************************************************9...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     +  N++I++ +e+++r+HiiDf+i +G+QWp+L++ L+sRpeg+p+lRiTg++ p++g   +e++eetg+rLa++Ae+++vpfef++ +a+++++
  XP_015876904.1 461 FFSNKTIMNIAEKATRLHIIDFGILYGFQWPCLIERLSSRPEGAPMLRITGIDLPQPGfrPAERVEETGRRLANYAETFKVPFEFKA-IAQKWDT 554
                     *********************************************************9*****************************.7****** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     +++e+L+++ +E+l+Vn++++  +llde+v ++s+rd vL+l+++++P+v+++   +  h+++ F +rf eal ++s+lfd+le+++pre  er+
  XP_015876904.1 555 IQVEDLKLRDDEVLVVNVMYRFRNLLDETVVVDSPRDIVLNLIRKINPNVFIHGIVNGAHSAPFFITRFREALFHFSTLFDMLEVNVPREIPERM 649
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      +E++++gre+ nv+aceg+er+er et+++W+ r ++aGF+++pl++++   ak  ++ ++ + + ++e+ ++l++gWk+r ++++S W+
  XP_015876904.1 650 LIEKVIFGREAINVIACEGSERTERPETYKQWQVRNQRAGFRQLPLNQEIWRMAKDRMKSFYHKDFVIDEDGEWLLQGWKGRIVYALSTWK 740
                     **************************************************************888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.515343720IPR005202Transcription factor GRAS
PfamPF035147.5E-118369740IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 743 aa     Download sequence    Send to blast
MVMDQHLTGL SINGLEYMRD DSLLGLSNQN KGDNESGTRD QFVDQNYANM LLFPPNSIPS  60
DSSPSFSVNQ EGDTHEDYDF SDLVLKYISQ MLMEEDIEEK TSMFHESSAL QAAEKSLYEL  120
LGEKYPSSPH NSPSPSHDQK HERPDESPGL QYGNCSSNTN GTSSVSLVDP GWIYDLGEYK  180
SPQVAAQSTS HSSHGSPNGT GNLMDGSMDS PVSILKVPDM FNENESVMQF KRGFEEASKF  240
IPNGNSPFFD LESNRLLPKE VKIETRDVVV KFENENLMDG SRRKKNPHSE DASSEGGRNN  300
KQSAVCSEST VSSEMFDMIL LNCGQGESAL REALQNGTSK NVQQNGQSKG SSGKTRGKKQ  360
GGKRDVVDLR TLLTLCAQAV AADDLRTANE FLKQIRQHSS PTGDGMQRIA HYFADGLEAR  420
IAGSGTQIHK TLITWPTSAA DILKAYHLFL AACPFKKLSN FFSNKTIMNI AEKATRLHII  480
DFGILYGFQW PCLIERLSSR PEGAPMLRIT GIDLPQPGFR PAERVEETGR RLANYAETFK  540
VPFEFKAIAQ KWDTIQVEDL KLRDDEVLVV NVMYRFRNLL DETVVVDSPR DIVLNLIRKI  600
NPNVFIHGIV NGAHSAPFFI TRFREALFHF STLFDMLEVN VPREIPERML IEKVIFGREA  660
INVIACEGSE RTERPETYKQ WQVRNQRAGF RQLPLNQEIW RMAKDRMKSF YHKDFVIDED  720
GEWLLQGWKG RIVYALSTWK PAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-493697405375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015876904.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLW9RQL50.0W9RQL5_9R
STRINGPOPTR_0008s05750.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14